Crockpot Breakfast Casserole - Easy Slow Cooker
30-MINUTE MEALS! Get the email series now
Royal Recipe

Crockpot Breakfast Casserole

5 from 1 vote
1 Comments
Sophia Marie
By: Sophia MarieUpdated: May 18, 2026
This post may contain affiliate links. Please read our disclosure policy.

A hearty, make-ahead slow cooker casserole loaded with hash browns, peppers, sausage, bacon, and sharp cheddar—perfect for busy mornings and holiday brunches.

Crockpot Breakfast Casserole

This Crockpot Breakfast Casserole has become my go-to for busy weekend mornings, holiday brunches, and sleepy mornings when I want something comforting waiting for the family. I first adapted this combination during a chilly December when I needed a hands-off dish that could feed a crowd; the slow cooker does the heavy lifting while the kitchen fills with the smell of bacon and melted cheese. The texture is a satisfying balance: a soft, custardy egg interior melded with tender hash browns and pockets of crisped bacon and sausage. Every bite delivers smoky, savory notes with a hint of sweetness from the peppers and a bright finish from freshly cracked black pepper.

I remember the first time I served this to a houseful of relatives—everyone returned for seconds, and an aunt who usually skips breakfast declared it the best way to start a day. The sharp cheddar creates a creamy, cohesive layer that traps the egg mixture around the meat and vegetables, while the slow, low heat ensures the eggs set without curdling. This is the kind of dish that tastes like a celebration and works for everyday life: make it for overnight guests, holiday mornings, or a weekend breakfast with minimal fuss and maximal results.

Why You'll Love This Recipe

  • Feeds a crowd effortlessly—one 6 to 7-quart slow cooker yields about 10 generous servings with no oven required.
  • Hands-off cooking: assemble in the morning or the night before, set to low, and come back to a steaming, ready-to-serve meal.
  • Uses pantry and fridge staples like frozen O’Brien hash browns, eggs, cheddar, and breakfast meats—easy to shop for and flexible.
  • Balanced textures and flavors: soft egg custard, tender potatoes, smoky bacon, savory sausage, and bright bell peppers.
  • Great for make-ahead and freeze-ahead: refrigerates well and can be portioned for quick reheating at breakfast or brunch.
  • Customizable to dietary needs—swap meats and cheese for plant-based options or use dairy-free cream alternatives.

Personally, I love how this dish simplifies hosting. I’ve prepared it the night before for holiday mornings, and it frees up time to mingle while giving a warm, comforting focal point on the buffet. Family members' favorite part is the way the cheese creates little golden pockets when reheated—the smell alone gets everyone drawn to the kitchen.

Ingredients

  • Frozen O’Brien hash browns (28 ounces): Use a quality brand that combines diced potatoes with peppers and onions; they add texture and reduce prep time. If you prefer plain potatoes, an equivalent weight of shredded or diced frozen potatoes works.
  • Green bell pepper (1 medium, diced, about 1 cup): Provides a fresh, mildly bitter contrast—choose firm peppers without soft spots for the best texture after slow cooking.
  • Red bell pepper (1 medium, diced, about 1 cup): Adds sweetness and color—pick vine-ripe peppers for maximum flavor.
  • Sweet yellow onion (1/2 cup, diced): Use a sweet variety for a gentle edge; saute briefly if you prefer a deeper caramelized flavor before layering.
  • Mild breakfast sausage (1 pound, cooked and crumbled): Choose a flavorful brand like Jimmy Dean for consistent seasoning, or homemade sausage if you want to control spices.
  • Smoked bacon (1 pound, cooked and crumbled): Thick-cut smoked bacon yields the best texture and deep smoky notes—reserve some of the rendered fat for sautéing if desired.
  • Sharp cheddar cheese (3 cups, freshly shredded): Freshly shredded melts smoother than pre-shredded; choose an aged sharp for tang and melt-in-your-mouth richness.
  • Large eggs (12): Room-temperature eggs whisk more evenly into the custard; large eggs are standard for the balance of liquid and structure here.
  • Half and half (3/4 cup): Contributes creaminess to the custard—use whole milk for a lighter version, or heavy cream for extra richness.
  • Onion powder (1 tablespoon), kosher salt (1 1/2 teaspoons), cracked black pepper (1 teaspoon): Seasonings that build savory depth—adjust salt to taste, especially if your meats or cheeses are on the salty side.

Instructions

Prepare the slow cooker: Generously spray a 6 to 7-quart slow cooker with nonstick cooking spray so the casserole releases cleanly. If your slow cooker runs hot, use a liner for easier cleanup. Place the cooker on a heat-safe surface and pre-position a spatula for serving. Layer the potatoes: Spread the frozen 28 ounces of O’Brien hash browns in an even layer across the bottom of the prepared slow cooker. Do not thaw—starting from frozen helps the casserole hold structure and prevents it from becoming watery. Add the vegetables: Evenly scatter the diced green and red bell peppers (about 1 cup each) and 1/2 cup diced sweet yellow onion over the hash browns. These vegetables will soften and release flavor slowly, adding sweetness and color without becoming mushy. Layer the meats: Sprinkle the cooked and crumbled 1 pound of mild breakfast sausage and the cooked, crumbled 1 pound of smoked bacon over the vegetables. Cook the sausage and bacon ahead—browning until just cooked through—and drain excess grease for a balanced final texture. Add the cheese: Scatter 3 cups of freshly shredded sharp cheddar evenly over the meat layer. Freshly shredding prevents anti-caking agents and gives a better melt; cheddar forms a cohesive barrier that helps the egg mixture set evenly above the layers. Whisk the custard: In a large mixing bowl combine 12 large eggs, 3/4 cup half and half, 1 tablespoon onion powder, 1 1/2 teaspoons kosher salt, and 1 teaspoon cracked black pepper. Whisk vigorously until completely homogenous and slightly frothy—this introduces small air bubbles for a lighter set. Combine and cook: Carefully pour the egg mixture over the layered cheese, spreading gently if needed. Cover and cook on low for 8 hours. The low-and-slow method yields a tender, custardy interior—avoid lifting the lid during cooking to maintain temperature consistency. Rest and serve: Let the casserole rest with the lid off for 10 minutes before slicing—this allows the eggs to firm slightly for cleaner portions. Serve warm, straight from the slow cooker. User provided content image 1

You Must Know

  • This holds well in the refrigerator for up to 4 days if cooled and stored in an airtight container; reheat portions in the microwave or oven until warm.
  • Freezes well for up to 3 months—freeze in individual portions on parchment, then transfer to a freezer-safe bag for quick breakfasts.
  • High in protein and fat—each serving provides sustained energy, making it ideal for busy mornings or post-activity meals.
  • Use a 6 to 7-quart slow cooker; smaller units may overflow, and larger units can affect cook time.

One of my favorite aspects is how forgiving the method is: if you swap a pepper or reduce the bacon slightly the result is still excellent. A tip from experience—if you want crisper bacon texture, reserve a small amount to sprinkle on top during the last 15 minutes of cooking or after resting to preserve crunch.

Storage Tips

Cool leftover portions to room temperature no longer than two hours, then refrigerate in shallow, airtight containers for up to four days. For freezing, portion into meal-size pieces, wrap tightly in plastic wrap, then place in a labeled freezer bag for up to three months. Reheat refrigerated portions in a 350°F oven for 12–15 minutes or in the microwave on medium power for 1–2 minutes, checking to avoid drying. To retain moisture when reheating in the oven, cover loosely with foil for the first 10 minutes.

Ingredient Substitutions

For a lighter version, substitute half and half with whole milk or use 3/4 cup unsweetened almond milk and an extra egg for structure. Replace breakfast sausage with turkey sausage for lower fat; use vegetarian crumbles or smoked tofu to make a vegetarian version (adjust seasonings). Swap sharp cheddar with Monterey Jack or pepper jack for a milder or spicier profile. If you want to reduce sodium, use low-sodium bacon and omit added salt, seasoning to taste after cooking.

Serving Suggestions

Serve slices with a simple green salad and hot sauce or salsa for brightness. For a brunch spread, offer toasted English muffins, fresh fruit salad, and coffee. Garnish with chopped chives or parsley and a dollop of sour cream or Greek yogurt for creaminess. This dish pairs well with roasted tomatoes or a citrusy arugula salad to balance the richness.

User provided content image 2

Cultural Background

The layered egg-and-potato casserole is rooted in American breakfast traditions where convenience meets comfort—think church brunches, holiday buffets, and potlucks. Variations exist across regions: in the Midwest, tater-tot casseroles and hash brown bakes are common, while the South favors heavier, sausage-forward versions. The slow-cooker adaptation modernizes the classic by offering a hands-off approach that fits contemporary schedules while preserving the homey, communal spirit of morning gatherings.

Seasonal Adaptations

Spring and summer versions can include fresh asparagus tips or zucchini; autumn invites roasted butternut squash and sage. For holiday mornings, add diced ham and swap in smoked Gouda for a festive, smoky twist. Adjust cooking technique slightly for high-water-content summer vegetables by sautéing them briefly to remove excess moisture before layering.

Meal Prep Tips

Assemble the layers the night before, cover the slow cooker, and refrigerate; in the morning, bring the cooker to room temperature for 15 minutes before cooking to reduce condensation and then set to low for 8 hours. For single-serving prep, portion slices into microwave-safe containers for grab-and-go breakfasts—reheat for one to two minutes on medium power. Label containers with reheating instructions and date for easy rotation.

Finally, this casserole is one of those dishes that invites personalization—mix the fillings, adapt the cheese, and make it yours. I hope it becomes a reliable staple in your home as it has in mine, bringing warmth, ease, and delicious breakfasts to busy mornings.

Pro Tips

  • Use freshly shredded cheese for smoother melting and better texture; pre-shredded cheese often contains anti-caking agents that change melt behavior.

  • Reserve a small amount of cooked bacon to sprinkle on top after cooking to preserve a crunchy texture contrast.

  • Keep ingredients at room temperature when possible—room-temperature eggs whisk more evenly into the custard for a uniform set.

This nourishing crockpot breakfast casserole recipe is sure to be a staple in your kitchen. Enjoy every moist, high protein slice — it is perfect for breakfast or as a wholesome snack any time.

FAQs about Recipes

Can I prepare this the night before?

Yes. Assemble the casserole the night before and refrigerate covered; cook on low for 8 hours in the morning. If refrigerated overnight, allow the slow cooker to come to room temperature 10–15 minutes before turning on.

Can I freeze leftovers?

Yes. Cool portions, wrap tightly, and freeze for up to 3 months. Thaw overnight in the refrigerator before reheating in the oven or microwave.

What size slow cooker should I use?

Use a 6 to 7-quart slow cooker for even cooking. Smaller units may overflow, larger units can change the cook time.

Tags

Slow Cookerbreakfastslow cookercasserolerecipefamily-friendlyweekend brunch
No ratings yet

Crockpot Breakfast Casserole

This Crockpot Breakfast Casserole recipe makes perfectly juicy, tender, and flavorful steak every time! Serve with potatoes and a side salad for an unforgettable dinner in under 30 minutes.

Servings: 10 steaks
Crockpot Breakfast Casserole
Prep:20 minutes
Cook:8 hours
Rest Time:10 mins
Total:8 hours 20 minutes

Ingredients

Potato Base

Vegetables

Meats

Dairy & Eggs

Seasoning

Instructions

1

Prepare the slow cooker

Spray a 6 to 7-quart slow cooker generously with nonstick cooking spray or use a liner. Position the cooker on a stable heat-resistant surface and have serving tools ready.

2

Layer the frozen potatoes

Spread 28 ounces of frozen O'Brien hash browns evenly across the bottom of the prepared slow cooker; keeping them frozen prevents excess water from forming and helps structure.

3

Add the vegetables

Scatter 1 cup diced green bell pepper, 1 cup diced red bell pepper, and 1/2 cup diced sweet yellow onion evenly over the potatoes to create a flavorful vegetable layer.

4

Add the cooked meats

Evenly sprinkle the cooked, crumbled 1 pound of mild breakfast sausage and 1 pound of cooked, crumbled smoked bacon over the vegetables; drain excess grease after cooking meats.

5

Top with cheese

Scatter 3 cups freshly shredded sharp cheddar over the meat layer, creating a cohesive layer that helps the egg mixture set and melt evenly.

6

Whisk the egg mixture

In a large bowl whisk 12 large eggs, 3/4 cup half and half, 1 tablespoon onion powder, 1 1/2 teaspoons kosher salt, and 1 teaspoon cracked black pepper until smooth and slightly frothy.

7

Combine and slow cook

Pour the egg mixture evenly over the layers in the slow cooker. Cover and cook on low for 8 hours—avoid lifting the lid while cooking to maintain consistent temperature.

8

Rest and serve

After cooking, remove the lid and allow the casserole to rest for 10 minutes to firm. Serve warm, sliced directly from the slow cooker; garnish as desired.

Last Step: Please leave a rating and comment letting us know how you liked this recipe! This helps our business to thrive and continue providing free, high-quality recipes for you.

Nutrition

Calories: 520kcal | Carbohydrates: 22g | Protein:
26g | Fat: 38g | Saturated Fat: 11g |
Polyunsaturated Fat: 8g | Monounsaturated Fat:
15g | Trans Fat: 1g | Cholesterol: 253mg | Sodium:
0mg | Potassium: 953mg | Fiber: 0g | Sugar:
0g | Vitamin A: 577IU | Vitamin C: 3mg | Calcium:
47mg | Iron: 6mg

Did You Make This?

Leave a comment & rating below or tag
@culinya on social media!

Crockpot Breakfast Casserole

Categories:

Crockpot Breakfast Casserole

Did You Make This?

Leave a comment & rating below or tag @culinya on social media!

Rate This Recipe

Share This Recipe

Enjoyed this recipe? Share it with friends and family, and don't forget to leave a review!

Comments (1)

Leave a Comment

0/1000 characters
Food Lover
1 day ago

This recipe looks amazing! Can't wait to try it.

Rating:

Comments are stored locally in your browser. Server comments are displayed alongside your local comments.

Family photo

Hi, I'm Sophia!

Chef and recipe creator specializing in delicious Slow Cooker cooking. Passionate about sharing easy-to-follow recipes that bring families together around the dinner table.

30-Minute Meals!

Join to receive our email series which contains a round-up of some of our quick and easy family favorite recipes.